DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and Prkch

DIOPT Version :10

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_032882.2 Gene:Prkch / 18755 MGIID:97600 Length:683 Species:Mus musculus


Alignment Length:82 Identity:14/82 - (17%)
Similarity:36/82 - (43%) Gaps:17/82 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 IVEPYNAILASHVAMEHSDCTFVLDNEALYDVCDRSLSVRE-PTYTNLNRLVAQAVSCVTASLRF 243
            :::||:.:.:.          :..:|.|...:....||.:. |.:.::|      ||.:::...|
Mouse    52 LMQPYDDMYSG----------YSYNNWATKSLASSPLSAKSFPFFNSMN------VSPLSSQPMF 100

  Fly   244 SGAINVDLLEFQTNLVP 260
            |...::..:...:::||
Mouse   101 SPPSSIPSMNMASSMVP 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992 14/82 (17%)
STKc_cPKC 353..672 CDD:270739
PrkchNP_032882.2 C2_PKC_epsilon 8..140 CDD:175981 14/82 (17%)
C1_nPKC_epsilon-like_rpt1 166..226 CDD:410385
C1_nPKC_epsilon-like_rpt2 244..298 CDD:410388
STKc_nPKC_eta 359..681 CDD:270742
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.