powered by:
Protein Alignment Pkc53E and F48G7.9
DIOPT Version :9
Sequence 1: | NP_725626.1 |
Gene: | Pkc53E / 48311 |
FlyBaseID: | FBgn0003091 |
Length: | 679 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_503271.1 |
Gene: | F48G7.9 / 185997 |
WormBaseID: | WBGene00018620 |
Length: | 125 |
Species: | Caenorhabditis elegans |
Alignment Length: | 65 |
Identity: | 25/65 - (38%) |
Similarity: | 30/65 - (46%) |
Gaps: | 9/65 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 VFNVKDHCFIARFFKQPTFCSHCKDFICGYQSGYAWMGFGKQGFQCQVCSYVVHKRCHEYVTFIC 104
|..|..|.|.|....|||.|:.|...| .|.||||::|..|..||||:||..:...|
Worm 21 VHEVAGHKFRAAALLQPTCCAFCSKII---------YGLGKQGYRCLGCETVVHKKCHASMITCC 76
Fly 105 104
Worm 77 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000117 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.