DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and Sgk3

DIOPT Version :9

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_001032848.1 Gene:Sgk3 / 170755 MGIID:2182368 Length:496 Species:Mus musculus


Alignment Length:547 Identity:192/547 - (35%)
Similarity:277/547 - (50%) Gaps:87/547 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 CDMNVHARCKE-NVPSLCGCDHTERRGRIYLEINVKENLLTVQIKEGRNLIPMDPNGLSDPYVKV 216
            |.|:....|.. ::||  ..:|.|::.|    ..|.:.|::|              |.|:.:|..
Mouse     5 CIMDYKESCPSVSIPS--SDEHREKKKR----FTVYKVLVSV--------------GRSEWFVFR 49

  Fly   217 KLIPDDK-DQSKKKTRTIKACLNPVWNETLTYDLKPEDKDRRILIEVWDWDRTSRNDFMGALSFG 280
            :....|| ..|.||.....|...|.               :||..:.:|      .||:.....|
Mouse    50 RYAEFDKLYNSLKKQFPAMALKIPA---------------KRIFGDNFD------PDFIKQRRAG 93

  Fly   281 ISEIIKN----PTNGWFKLLTQDEGEYYNVPCADDEQDLLKLKQKPSQKKPMV---MRSDTNTHT 338
            ::|.|:|    |             |.||.|   |.:..|::.....|..|..   .||.:..|:
Mouse    94 LNEFIQNLVRYP-------------ELYNHP---DVRAFLQMDSPRHQSDPSEDEDERSTSKPHS 142

  Fly   339 SSKKDMI--------RATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECT 395
            :|:...:        :.|||:|:||:|||||||||||:||...:.||:|:|:|.:::...:.:..
Mouse   143 TSRNINLGPTGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHI 207

  Fly   396 MIEKRVLALGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAA 460
            |.|:.||....|.||||.||..|||.::|:||:::||||:|.|.:|:...|.||.|.|||||||:
Mouse   208 MAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEPRARFYAAEIAS 272

  Fly   461 GLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQP 525
            .|.:||:..|:|||||.:|:|||:.|||.:.|||:|||.|....||.||||||:|:|||:|..||
Mouse   273 ALGYLHSIKIVYRDLKPENILLDSMGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQP 337

  Fly   526 YGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNK 590
            |..:||||..|.:|||||.|.|||...|..|::..|....::....:|..|....:..|.|....
Mouse   338 YDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLNLRPGVSLTAWSILEELLEKNRQN 402

  Fly   591 RLGCGSSGEED---VRLHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSEKT--DLT 650
            |||    .:||   ::.||||..:.|..:..:::.|||.|.:....|:.|||..||.|..  .:.
Mouse   403 RLG----AKEDFLEIQNHPFFESLSWTDLVQKKIPPPFNPNVAGPDDIRNFDAVFTEETVPYSVC 463

  Fly   651 PTDKVFMMNLDQSE----FVGFSYMNP 673
            .:....::|....|    ||||||..|
Mouse   464 VSSDYSIVNASVLEADDAFVGFSYAPP 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386 5/20 (25%)
C2_PKC_alpha_gamma 177..307 CDD:175992 27/134 (20%)
STKc_cPKC 353..672 CDD:270739 144/327 (44%)
Sgk3NP_001032848.1 PX_CISK 12..120 CDD:132780 35/164 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..157 6/35 (17%)
S_TKc 162..419 CDD:214567 124/260 (48%)
STKc_SGK3 165..490 CDD:270755 144/328 (44%)
Nuclear localization signal. /evidence=ECO:0000250 195..205 1/9 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614710at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.