DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and RSKR

DIOPT Version :9

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_001167574.1 Gene:RSKR / 124923 HGNCID:26314 Length:410 Species:Homo sapiens


Alignment Length:308 Identity:92/308 - (29%)
Similarity:151/308 - (49%) Gaps:36/308 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 IKVLG---KGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDV-EC---TMIEKRVLALGEKPPF 410
            :|:||   |||||.||.......:.::|:|::.|..::|.|.| :|   ..|::::     ..||
Human   107 LKILGLVAKGSFGTVLKVLDCTQKAVFAVKVVPKVKVLQRDTVRQCKEEVSIQRQI-----NHPF 166

  Fly   411 LVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDL 475
            :..|...:|....||.:..|.: .||.......|.|.|.....:|||:...|.:||..||::||:
Human   167 VHSLGDSWQGKRHLFIMCSYCS-TDLYSLWSAVGCFPEASIRLFAAELVLVLCYLHDLGIMHRDV 230

  Fly   476 KLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLY 540
            |::|:|||..||:|:.|||:.: ::.......|.|||..|:|||::...||..:.|||:.||||:
Human   231 KMENILLDERGHLKLTDFGLSR-HVPQGAQAYTICGTLQYMAPEVLSGGPYNHAADWWSLGVLLF 294

  Fly   541 EMLVGQPPFDGE-DEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRL 604
            .:..|:.|...| |...:.|::|..:...|.||::.........|.:.|..||    ......::
Human   295 SLATGKFPVAAERDHVAMLASVTHSDSEIPASLNQGLSLLLHELLCQNPLHRL----RYLHHFQV 355

  Fly   605 HPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSEKTDLTPT 652
            |||||.:            .|.|::..::.|:     |.:|.....|:
Human   356 HPFFRGV------------AFDPELLQKQPVN-----FVTETQATQPS 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992
STKc_cPKC 353..672 CDD:270739 92/308 (30%)
RSKRNP_001167574.1 S_TKc 108..324 CDD:214567 74/222 (33%)
STKc_AGC 115..359 CDD:270693 80/254 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.