DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and SGK2

DIOPT Version :9

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_001186193.1 Gene:SGK2 / 10110 HGNCID:13900 Length:367 Species:Homo sapiens


Alignment Length:353 Identity:146/353 - (41%)
Similarity:217/353 - (61%) Gaps:8/353 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 PMVMRSDTNTHTS-SKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDD 390
            |...|::.|.:.. |.....:.|||:|:||:|||::||||||:||.....||:|:|:|..|::..
Human    11 PQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKKK 75

  Fly   391 DVECTMIEKRVLALGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYA 455
            :....|.|:.||....:.||||.|...|||.::|:||::|||||:|.|.:|:..:|.||.|.|||
Human    76 EQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYA 140

  Fly   456 AEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEI 520
            ||:|:.:.:||:..|:|||||.:|:|||..|||.:.|||:|||.:..:.||.||||||:|:|||:
Human   141 AEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEV 205

  Fly   521 ILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLT 585
            :..:||.::||||..|.:|||||.|.|||..:|..:::..|....:..|...:..|.:..:..|.
Human   206 LRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLH 270

  Fly   586 KQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSEKTD-- 648
            |...:|||..:...| ::.|.||..|:|:.:.::.:.|||.|.:....|:.:||.:||.|...  
Human   271 KDQRQRLGSKADFLE-IKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKS 334

  Fly   649 --LTPTDKVFMMNLDQSEFVGFSYMNPE 674
              .|| |.|...:...|.|:||||. ||
Human   335 IGCTP-DTVASSSGASSAFLGFSYA-PE 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992
STKc_cPKC 353..672 CDD:270739 136/322 (42%)
SGK2NP_001186193.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 3/14 (21%)
STKc_SGK2 39..359 CDD:270754 136/322 (42%)
Nuclear localization signal. /evidence=ECO:0000250 68..78 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614710at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.