DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and AKT3

DIOPT Version :9

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_001357003.1 Gene:AKT3 / 10000 HGNCID:393 Length:479 Species:Homo sapiens


Alignment Length:344 Identity:157/344 - (45%)
Similarity:221/344 - (64%) Gaps:10/344 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 DTNTHTSSKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMI 397
            |.:|....:|.|   .||:::|:||||:||||:|...|.|.:.||:|||||:|||..|:|..|:.
Human   134 DASTTHHKRKTM---NDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLT 195

  Fly   398 EKRVLALGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGL 462
            |.|||. ..:.|||..|...|||.|||.|||||||||:|.|.:.:...|.|....||.|||.:.|
Human   196 ESRVLK-NTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSAL 259

  Fly   463 FFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYG 527
            .:||:..|:||||||:|::||.|||:||.|||:|||.|....|.|||||||:|:|||::....||
Human   260 DYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYG 324

  Fly   528 KSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRL 592
            ::||||..||::|||:.|:.||..:|.|:||..|...::.:|::||.:||....|.|.|.|||||
Human   325 RAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRL 389

  Fly   593 GCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSEKTDLTPTDKV-- 655
            |.|....:::..|.||..::|:.:.::::.|||||::....|...||::||::...:||.:|.  
Human   390 GGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDE 454

  Fly   656 ----FMMNLDQSEFVGFSY 670
                .|.|..:..|..|||
Human   455 DGMDCMDNERRPHFPQFSY 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992
STKc_cPKC 353..672 CDD:270739 151/324 (47%)
AKT3NP_001357003.1 PH_PKB 4..110 CDD:269947
STKc_PKB_gamma 132..479 CDD:270745 157/344 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 458..479 6/16 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614710at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.