DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NME2 and nmdyn-D7

DIOPT Version :10

Sequence 1:NP_002503.1 Gene:NME2 / 4831 HGNCID:7850 Length:152 Species:Homo sapiens
Sequence 2:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster


Alignment Length:146 Identity:38/146 - (26%)
Similarity:63/146 - (43%) Gaps:26/146 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     7 TFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLV-KYMNS 70
            |...|||..::.||:|:||......||||.||:.:..:..:.::.|      ..:.|:| :|:  
  Fly   248 TLAIIKPHSIKDGLLGDIISEILSNGFRLTAMRMILMARINCEEFY------EVYRGVVPEYI-- 304

Human    71 GPVVAMVWEGLNVV----------KTGRVMLGETNPADS------KPGTIRGDFCIQVGRNIIHG 119
             |:||.:..|:.:.          ||.|.......|.|.      :|.|:|..|.....:|.:|.
  Fly   305 -PMVAQLASGVCMCMEIACADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNAVHC 368

Human   120 SDSVKSAEKEISLWFK 135
            :|....:..|:...||
  Fly   369 TDLPDDSNLELQYMFK 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NME2NP_002503.1 Interaction with AKAP13. /evidence=ECO:0000269|PubMed:15249197 1..66 18/59 (31%)
PTZ00093 3..151 CDD:173387 38/146 (26%)
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDPk7B 246..383 CDD:239875 36/143 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.