DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mus101 and SLF1

DIOPT Version :9

Sequence 1:NP_524909.1 Gene:mus101 / 48309 FlyBaseID:FBgn0002878 Length:1425 Species:Drosophila melanogaster
Sequence 2:NP_115666.2 Gene:SLF1 / 84250 HGNCID:25408 Length:1058 Species:Homo sapiens


Alignment Length:232 Identity:72/232 - (31%)
Similarity:107/232 - (46%) Gaps:40/232 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1198 GSPK--MQYAGIPCFSISCGDDDEKRAELIARI--TQLGGKVCENLVNYDDSCTHLLCERPNRGE 1258
            |:||  :|..|...      ::.|...:|:.::  |.:..:..:|       ||||:.||..:.|
Human     4 GTPKHIIQMTGFKM------EEKEALVKLLLKLDCTFIKSEKYKN-------CTHLIAERLCKSE 55

  Fly  1259 KMLACIAAGKWILNIQYIEQSHARGDFLDETLYEWGNPKAINLPTLAPEEEPIAAAVHRWRTELS 1323
            |.||..|||||||...||..|...|.:||||.||||. |.......:|:   :.:|..|||.||.
Human    56 KFLAACAAGKWILTKDYIIHSAKSGRWLDETTYEWGY-KIEKDSRYSPQ---MQSAPKRWREELK 116

  Fly  1324 ACGG-GAFSDHRVILSM--NERSGAPIRNVLRAGGACILEP-TTPFSKDPVAKSASHCFVDVK-- 1382
            ..|. |||...:|:|.:  ::||.:.|| ||.||.|.::.| ::|.....|..|.:....:.:  
Human   117 RTGAPGAFHRWKVVLLVRTDKRSDSLIR-VLEAGKANVILPKSSPSGITHVIASNARIKAEKEKD 180

  Fly  1383 --KAPLSTQDMEYLHKCGVQVLSQIAINAYLMNGRDA 1417
              |||...          :|.|....:...:.|..|:
Human   181 NFKAPFYP----------IQYLGDFLLEKEIQNDEDS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mus101NP_524909.1 BRCT 118..188 CDD:278934
BRCT 216..290 CDD:278934
BRCT 397..472 CDD:278934
BRCT 707..778 CDD:278934
BRCT 1210..1279 CDD:237994 23/70 (33%)
SLF1NP_115666.2 BRCT <12..88 CDD:320726 30/88 (34%)
ANK 803..918 CDD:238125
ANK 1 806..836
ANK repeat 807..838 CDD:293786
ANK repeat 840..871 CDD:293786
ANK 2 840..869
ANK repeat 874..904 CDD:293786
ANK 3 874..903
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1929
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.