DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mus101 and Slf1

DIOPT Version :9

Sequence 1:NP_524909.1 Gene:mus101 / 48309 FlyBaseID:FBgn0002878 Length:1425 Species:Drosophila melanogaster
Sequence 2:NP_001099870.1 Gene:Slf1 / 294601 RGDID:1304857 Length:1059 Species:Rattus norvegicus


Alignment Length:190 Identity:63/190 - (33%)
Similarity:91/190 - (47%) Gaps:27/190 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1245 SCTHLLCERPNRGEKMLACIAAGKWILNIQYIEQSHARGDFLDETLYEWGNPKAINLPTLAPEEE 1309
            :||||:.||..:.||.||..|||||:|...||..|...|.:||||.||||. |.......:|:  
  Rat    42 NCTHLIAERLCKSEKFLAACAAGKWVLTKDYIIHSAKSGRWLDETTYEWGY-KIEKDSHYSPQ-- 103

  Fly  1310 PIAAAVHRWRTELSACGG-GAFSDHRVILSM--NERSGAPIRNVLRAGGACILEP-TTPFSKDPV 1370
             :.:|..|||.||...|. |||...:|:|.:  ::||.:.:| ||.||.|.::.| ::|.....|
  Rat   104 -MQSAPKRWREELKRTGAPGAFHRWKVVLLVRADKRSDSLVR-VLEAGKANVILPRSSPSGITHV 166

  Fly  1371 AKSASHCFVDVK----KAPLSTQDMEYLHKCGVQVLSQIAINAYLMNGRDADLG----KY 1422
            ..|.:....:.:    |||...          :|.|....:...:.|..|:.:.    ||
  Rat   167 IASNARISAEREQENFKAPFYP----------IQYLGDFLLEKEIQNDEDSQISSGRTKY 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mus101NP_524909.1 BRCT 118..188 CDD:278934
BRCT 216..290 CDD:278934
BRCT 397..472 CDD:278934
BRCT 707..778 CDD:278934
BRCT 1210..1279 CDD:237994 18/33 (55%)
Slf1NP_001099870.1 BRCT 15..78 CDD:237994 19/35 (54%)
ANK 804..925 CDD:238125
ANK repeat 808..839 CDD:293786
Ank_2 812..899 CDD:289560
ANK repeat 841..872 CDD:293786
ANK repeat 875..899 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1929
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.