DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mus101 and rgf3

DIOPT Version :9

Sequence 1:NP_524909.1 Gene:mus101 / 48309 FlyBaseID:FBgn0002878 Length:1425 Species:Drosophila melanogaster
Sequence 2:NP_588115.1 Gene:rgf3 / 2539437 PomBaseID:SPCC645.06c Length:1275 Species:Schizosaccharomyces pombe


Alignment Length:268 Identity:64/268 - (23%)
Similarity:88/268 - (32%) Gaps:77/268 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   786 PFVGYLVGKSPEDFPISPRLRDSNSRTARRPNESTLVAQPD-VTMEEAENQPAGSVTPVTAGS-P 848
            ||:......||..|..||....: |..:||....|:.:.|. .|..:..|:|..|....|..| |
pombe    58 PFLSKRSNNSPHRFSYSPPQHPA-SINSRRVASYTVQSSPSRTTYRQLPNEPQNSAAYTTYSSFP 121

  Fly   849 GA--------------PELTPLRNKR--------VSELAGIPGGSALH-----RGSNSTSSPDSP 886
            .|              |.||...||:        :.|....||||.:|     ...:|.||..||
pombe   122 NALFDDFSPNNPLDTDPFLTSPGNKQNTVDSFRPLPETPVSPGGSLVHPLPRPPLPSSVSSHSSP 186

  Fly   887 CTPLSQVGAQQYNLDFLEQFVQRLDTEEGKDCVREIIREMRENQTPE----LERIRRQACTP--- 944
            .:..|....  |:|                      ..::..:.:||    |...|..|.||   
pombe   187 YSTTSSTSL--YSL----------------------YNDISLSCSPEPYLPLSPTRSPARTPSPI 227

  Fly   945 --VSRKHQRP----APGIPDFCLTPEFQQRMADDFERRWRLPTMKI------KPDTPLAVIRQRV 997
              .|....||    :|.:.  .|||.....:..|.....:||.:.:      |..:||.....| 
pombe   228 RLYSSDALRPQSPLSPSVE--YLTPPNPYSLKSDISSTRQLPKIPVQDYASGKISSPLITRTHR- 289

  Fly   998 MRITCETL 1005
             |...|||
pombe   290 -RAQSETL 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mus101NP_524909.1 BRCT 118..188 CDD:278934
BRCT 216..290 CDD:278934
BRCT 397..472 CDD:278934
BRCT 707..778 CDD:278934
BRCT 1210..1279 CDD:237994
rgf3NP_588115.1 RhoGEF 470..656 CDD:279015
PH-like 695..850 CDD:302622
CNH 939..1236 CDD:279162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47399
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.