DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mus101 and slf1

DIOPT Version :9

Sequence 1:NP_524909.1 Gene:mus101 / 48309 FlyBaseID:FBgn0002878 Length:1425 Species:Drosophila melanogaster
Sequence 2:XP_012823830.1 Gene:slf1 / 100495961 XenbaseID:XB-GENE-983324 Length:911 Species:Xenopus tropicalis


Alignment Length:138 Identity:47/138 - (34%)
Similarity:71/138 - (51%) Gaps:13/138 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1244 DSCTHLLCERPNRGEKMLACIAAGKWILNIQYIEQSHARGDFLDETLYEWGNPKAINLPTLAPEE 1308
            ::||||:.:.|.|.||.||..:||||:|...|:..|..||.:||||:||||    ..:...:|..
 Frog    48 ENCTHLIAKNPCRSEKWLAACSAGKWVLIKDYVINSVQRGRWLDETIYEWG----YRIERHSPYS 108

  Fly  1309 EPIAAAVHRWRTELSACG-GGAFSDHRV--ILSMNERSGAPIRNVLRAGGACILEPTTPFSKDPV 1370
            ..:.:|..|||..|:..| .|||...:|  ::...::.......|||||.|.|.      :.:.:
 Frog   109 PQMQSAPKRWREHLTRTGVKGAFRKWKVAILVDKGQKQREAFERVLRAGQAIIC------NAEEL 167

  Fly  1371 AKSASHCF 1378
            .:..:|.|
 Frog   168 HEEVTHVF 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mus101NP_524909.1 BRCT 118..188 CDD:278934
BRCT 216..290 CDD:278934
BRCT 397..472 CDD:278934
BRCT 707..778 CDD:278934
BRCT 1210..1279 CDD:237994 16/34 (47%)
slf1XP_012823830.1 BRCT 16..>67 CDD:294035 9/18 (50%)
ANK 655..784 CDD:238125
ANK repeat 659..690 CDD:293786
Ank_2 663..750 CDD:289560
ANK repeat 692..723 CDD:293786
ANK repeat 726..750 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1061
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.