DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP1B3 and GABA-B-R1

DIOPT Version :9

Sequence 1:NP_001670.1 Gene:ATP1B3 / 483 HGNCID:806 Length:279 Species:Homo sapiens
Sequence 2:NP_001246033.1 Gene:GABA-B-R1 / 34878 FlyBaseID:FBgn0260446 Length:841 Species:Drosophila melanogaster


Alignment Length:161 Identity:33/161 - (20%)
Similarity:59/161 - (36%) Gaps:48/161 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    31 RTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQ-TLNDEVPKYRDQIPSPGLMVFPKPVTALEYT 94
            :..:.|.|        |..::.|.|..:.::|. .:.|.:.:|.:                   |
  Fly   574 KKVEPWKL--------YTMVSGLLSIDLVILLSWQIFDPLQRYLE-------------------T 611

Human    95 FSRSDPTSYAGYIEDLKKFLKPYT--LEEQKNLTVCPDGALFEQKGPVYVACQF------PISLL 151
            |...||.|..   :|:|  ::|..  .|.|:|....  |.::..||.:.|...|      .|.:.
  Fly   612 FPLEDPVSTT---DDIK--IRPELEHCESQRNSMWL--GLVYGFKGLILVFGLFLAYETRSIKVK 669

Human   152 QACSGMNDPDF-GYSQGNPCILVKMNRIIGL 181
            |    :||..: |.|..|..:|..:...:|:
  Fly   670 Q----INDSRYVGMSIYNVVVLCLITAPVGM 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP1B3NP_001670.1 Na_K_ATPase_bet 1..279 CDD:273446 33/161 (20%)
immunoglobulin-like. /evidence=ECO:0000250 186..279
GABA-B-R1NP_001246033.1 PBP1_GABAb_receptor 34..437 CDD:107361
ANF_receptor 52..415 CDD:279440
7tm_3 476..730 CDD:278433 33/161 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.