DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP1B3 and CG33310

DIOPT Version :9

Sequence 1:NP_001670.1 Gene:ATP1B3 / 483 HGNCID:806 Length:279 Species:Homo sapiens
Sequence 2:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster


Alignment Length:326 Identity:67/326 - (20%)
Similarity:109/326 - (33%) Gaps:125/326 - (38%)


- Green bases have known domain annotations that are detailed below.


Human     2 TKNEKKSLNQSL-------AEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMW 59
            ||.::::..:..       .||:...:|...|::..|....| |..|.:.|.|.....:||...:
  Fly   563 TKEDRRTYYKGCEYHFPGRTEWRRLFFNKIHGKYKLRRPSHW-LYTLVFSVLYILFVIIFSMAWF 626

Human    60 VMLQ-TLNDEVPKYRDQIP----SP-GLMVFPKPVTALEYTFSRSDPT----SYAGYIEDLKKFL 114
            ..:: ..:.:||..:...|    :| |....||.|     :|...:.|    .|||.:       
  Fly   627 DFIKDDASRKVPMIKMAQPFISFTPIGPRTNPKAV-----SFDPRNSTEVMEKYAGIM------- 679

Human   115 KPYTLEEQKNLTVCPDGALFEQKG-----PVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVK 174
                             ||.|:.|     |.:..|            ..:..|||..|.||:.:|
  Fly   680 -----------------ALLEKYGDYGHNPRFGTC------------TANEKFGYPSGEPCVFLK 715

Human   175 MNRIIGLKPE-------------------GVPR----------------IDCVS-KNEDI----- 198
            :|||||.|.|                   .:.|                |.|.| |::::     
  Fly   716 VNRIIGFKTEPYINSDELVKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFH 780

Human   199 PNVAVYPHNGMID--LKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQ 261
            |..|:......|:  ::|....|||..             |.||:..:.|.::.|     |||:.
  Fly   781 PEPAIRTEYTDIEEKIEYIANEGKKSF-------------FGPNDVNRIVALKIK-----NLKAN 827

Human   262 D 262
            :
  Fly   828 E 828

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP1B3NP_001670.1 Na_K_ATPase_bet 1..279 CDD:273446 67/326 (21%)
immunoglobulin-like. /evidence=ECO:0000250 186..279 20/101 (20%)
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 34/144 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160446
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.