DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NMBR and CCHa1-R

DIOPT Version :9

Sequence 1:NP_002502.2 Gene:NMBR / 4829 HGNCID:7843 Length:390 Species:Homo sapiens
Sequence 2:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster


Alignment Length:418 Identity:141/418 - (33%)
Similarity:220/418 - (52%) Gaps:56/418 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    13 TGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYLLIITVGLLGNIMLVKIFITNSAMRSV 77
            ||::|:.|.....|..::|.  |...|..|   :|.|:.||..||:|||..|:.:|::...||:|
  Fly    56 TGSSENFSELVTTETPYVPY--GRRPETYI---VPILFALIFVVGVLGNGTLIVVFLSVRQMRNV 115

Human    78 PNIFISNLAAGDLLLLLTCVPVDASRYFFDEWMFGKVGCKLIPVIQLTSVGVSVFTLTALSADRY 142
            ||.:|.:||..|||:::|.||:.::.|..:.|.:|...|.|...::..|:|||||||||||.|||
  Fly   116 PNTYILSLALADLLVIITTVPLASTVYTVEYWPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRY 180

Human   143 RAIVNPM-DMQTSG----ALLRTCVKAMGIWVVSVLLAVPEAVFSEVARISSLDNSSFTACIPYP 202
            .|||:|: .....|    |...|...|:.||::::|..:|..:.|.:..: .::..|...|.|||
  Fly   181 FAIVDPLRKFHAHGGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHL-GINEKSIVICYPYP 244

Human   203 QTDEL-HPKIHSVLIFLVYFLIPLAIISIYYYHIAKTLIKSAHNLPGEYNEHTKKQMETRKRLAK 266
            :...: :.|...:|.||||:.|||.:|:::|..||..|:.|| ::|||. :...:|:..|:::|.
  Fly   245 EEWGINYAKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYSA-SVPGEI-QGAVRQVRARRKVAV 307

Human   267 IVLVFVGCFIFCWFPNHILYMYRSF------NYNEIDPSLGHMIVTLVARVLSFGNSCVNPFALY 325
            .||.||..|..|:.|.|:.:::..|      :||    :..| ::.:||..:||.|||.||.|||
  Fly   308 TVLAFVVIFGICFLPYHVFFLWFYFWPTAQDDYN----AFWH-VLRIVAYCMSFANSCANPVALY 367

Human   326 LLSESFRRHFNSQLCC----GR-----------------------KSYQERGTSYLLSSSAVRMT 363
            .:|.:||:|||..|.|    ||                       |.:|.|.:.|   .|.:|..
  Fly   368 FVSGAFRKHFNRYLFCRGASGRRKKRGQHDTFCMHRDTSLTSTASKRFQSRHSCY---QSTIRSC 429

Human   364 SLKSNAKNMVTNSVLLNGHSMKQ-EMAL 390
            .|:......:.|....||.::.. |:||
  Fly   430 RLQETTITTLPNGGNQNGANISAVELAL 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NMBRNP_002502.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 4/8 (50%)
7tm_1 60..322 CDD:278431 98/273 (36%)
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 47/99 (47%)
7tm_1 98..364 CDD:278431 98/273 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 177 1.000 Domainoid score I3598
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H20560
Inparanoid 1 1.050 217 1.000 Inparanoid score I3601
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153238at2759
OrthoFinder 1 1.000 - - FOG0001846
OrthoInspector 1 1.000 - - mtm8658
orthoMCL 1 0.900 - - OOG6_106543
Panther 1 1.100 - - O PTHR45695
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4897
SonicParanoid 1 1.000 - - X1046
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1212.000

Return to query results.
Submit another query.