DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NKX6-1 and eve

DIOPT Version :10

Sequence 1:NP_006159.2 Gene:NKX6-1 / 4825 HGNCID:7839 Length:367 Species:Homo sapiens
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:145 Identity:40/145 - (27%)
Similarity:57/145 - (39%) Gaps:46/145 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   156 LLA---GLPRFSSLSPPPPPPGLYFSPSAAAVAAVGRYPKPLAELPGRTPIFWPGVMQSPPWRDA 217
            |||   |.|:    :|||.|.....||..:...:.|      :|:|.                  
  Fly    30 LLATQYGKPQ----TPPPSPNECLSSPDNSLNGSRG------SEIPA------------------ 66

Human   218 RLACTPHQGSILLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKV 282
                           |...:..|..|:..|:..|||.|.:..|::.|.|..||..|.:.||.:||
  Fly    67 ---------------DPSVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKV 116

Human   283 WFQNRRTKWRKKHAA 297
            ||||||.|.:::..|
  Fly   117 WFQNRRMKDKRQRIA 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NKX6-1NP_006159.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..133
Repressor domain. /evidence=ECO:0000250 102..268 25/114 (22%)
Homeodomain 235..293 CDD:459649 24/57 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..367 1/4 (25%)
Involved in DNA-binding. /evidence=ECO:0000250 306..367
eveNP_523670.2 Homeodomain 71..127 CDD:459649 24/55 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.