DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNaseII and flp-25

DIOPT Version :9

Sequence 1:NP_650672.1 Gene:DNaseII / 48228 FlyBaseID:FBgn0000477 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001022665.1 Gene:flp-25 / 3564828 WormBaseID:WBGene00010575 Length:96 Species:Caenorhabditis elegans


Alignment Length:74 Identity:18/74 - (24%)
Similarity:33/74 - (44%) Gaps:13/74 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLCFVLL--FVWFFYQNEAKSK--VSCKDEAGNDVDWWHLYKLPKHYQ----HNDLGKDTSGLKY 59
            |:.::|:  .|......|||.:  :.|:::....|| ..|...|:.|:    .|.|.:.:|..| 
 Worm     5 SMIYLLVAFLVLLCATTEAKKECSIDCQEDGSAAVD-LGLVLPPELYESTRLSNLLARPSSQFK- 67

  Fly    60 LYVTSQNYD 68
               ..::||
 Worm    68 ---MKRDYD 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNaseIINP_650672.1 PLDc_DNaseII_1 21..164 CDD:197219 12/54 (22%)
DNase_II 24..360 CDD:281283 12/49 (24%)
PLDc_DNaseII_2 213..362 CDD:197220
flp-25NP_001022665.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3825
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.