DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aprt and APT2

DIOPT Version :9

Sequence 1:NP_001286908.1 Gene:Aprt / 48224 FlyBaseID:FBgn0000109 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_010729.3 Gene:APT2 / 852051 SGDID:S000002849 Length:181 Species:Saccharomyces cerevisiae


Alignment Length:180 Identity:65/180 - (36%)
Similarity:100/180 - (55%) Gaps:5/180 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SISAEDKLDYVKSKIGEYPNFPKEGILFRDIFGALTDPKACVYLRDLLVDHIRESAPEAEV--IV 66
            ||| |.....:|:...::.:||.||..|.|....:.:|.....|......|:.|...:.::  |.
Yeast     2 SIS-ESYAKEIKTAFRQFTDFPIEGEQFEDFLPIIGNPTLFQKLVHTFKTHLEEKFGKEKIDFIA 65

  Fly    67 GLDSRGFLFNLLIATELGLGCAPIRKKGKLAGEVVSVEY-KLEYGIDTFELQKSAIKPGQKVVVV 130
            |:::||.||...:|..||:|..|||:.|||.||..|:.: ||::. :.||:|..||.....||||
Yeast    66 GIEARGLLFGPSLALALGVGFVPIRRVGKLPGECASITFTKLDHE-EIFEMQVEAIPFDSNVVVV 129

  Fly   131 DDLLATGGSLVAATELIGKVGGVVVESLVVMELVGLEGRKRLDGKVHSLI 180
            ||:|||||:..||.:||.:||..::|...|:.|..|.|.::|...:.|::
Yeast   130 DDVLATGGTAYAAGDLIRQVGAHILEYDFVLVLDSLHGEEKLSAPIFSIL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AprtNP_001286908.1 PRK02304 9..182 CDD:235028 61/175 (35%)
APT2NP_010729.3 PRTases_typeI 11..180 CDD:412297 61/170 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I1477
eggNOG 1 0.900 - - E1_COG0503
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I1156
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62323
OrthoFinder 1 1.000 - - FOG0001975
OrthoInspector 1 1.000 - - otm46607
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR32315
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1290
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.