DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aprt and APT4

DIOPT Version :9

Sequence 1:NP_001286908.1 Gene:Aprt / 48224 FlyBaseID:FBgn0000109 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001319911.1 Gene:APT4 / 826856 AraportID:AT4G12440 Length:182 Species:Arabidopsis thaliana


Alignment Length:183 Identity:78/183 - (42%)
Similarity:118/183 - (64%) Gaps:3/183 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSPSISAEDKLDYVKSKIGEYPNFPKEGILFRDIFGALTDPKACVYLRDLLVDHIRESAPEAEVI 65
            ||.:...:.::|.:|:||...|:|||:||:|:||...|.||||.....||.|:..|:.  ...|:
plant     1 MSENEVKDPRIDGIKTKIRVVPDFPKKGIMFQDITTLLLDPKAFKDTIDLFVERYRDM--NISVV 63

  Fly    66 VGLDSRGFLFNLLIATELGLGCAPIRKKGKLAGEVVSVEYKLEYGIDTFELQKSAIKPGQKVVVV 130
            .|:::|||:|...||..:|....|:||..||.|:::..||:||||.|..|:...|:..|.:.:||
plant    64 AGIEARGFIFGSPIALAIGAKFVPLRKPKKLPGQIIFEEYELEYGSDRLEMHVEAVDSGDRALVV 128

  Fly   131 DDLLATGGSLVAATELIGKVGGVVVESLVVMELVGLEGRKRLDGK-VHSLIKY 182
            |||:||||:|.||..|:.:||..|:|...|:||..|:||:||:|| ::.|::|
plant   129 DDLIATGGTLCAAMNLLKRVGAEVIECACVIELPELKGRERLEGKPLYVLVEY 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AprtNP_001286908.1 PRK02304 9..182 CDD:235028 75/173 (43%)
APT4NP_001319911.1 PLN02293 1..182 CDD:177930 78/183 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 100 1.000 Domainoid score I2348
eggNOG 1 0.900 - - E1_COG0503
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I1747
OMA 1 1.010 - - QHG62323
OrthoDB 1 1.010 - - D1291050at2759
OrthoFinder 1 1.000 - - FOG0001975
OrthoInspector 1 1.000 - - otm2722
orthoMCL 1 0.900 - - OOG6_101012
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1290
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.