DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aprt and aprt

DIOPT Version :9

Sequence 1:NP_001286908.1 Gene:Aprt / 48224 FlyBaseID:FBgn0000109 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001007941.1 Gene:aprt / 493317 XenbaseID:XB-GENE-5848953 Length:180 Species:Xenopus tropicalis


Alignment Length:179 Identity:82/179 - (45%)
Similarity:117/179 - (65%) Gaps:1/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISAEDKLDYVKSKIGEYPNFPKEGILFRDIFGALTDPKACVYLRDLLVDHIRESAPEAEVIVGLD 69
            :|.::|.:.:::.|..:|:||..||.||||...|.||.|...:.||...|:|.:.|:.:||.|||
 Frog     1 MSDQEKEEIIRTAIRAFPDFPSPGICFRDITPVLKDPLAFCSVIDLFEKHLRANFPKIDVIAGLD 65

  Fly    70 SRGFLFNLLIATELGLGCAPIRKKGKLAGEVVSVEYKLEYGIDTFELQKSAIKPGQKVVVVDDLL 134
            ||||||...:|....:|...|||||||.|...||.|.||||....|:|..|::||||||::||||
 Frog    66 SRGFLFGPSLAQRFNIGFLLIRKKGKLPGPTESVSYSLEYGKAELEMQYDAVEPGQKVVLIDDLL 130

  Fly   135 ATGGSLVAATELIGKVGGVVVESLVVMELVGLEGRKRLDG-KVHSLIKY 182
            ||||::.||.||:.:....:::.|||:||..|:|.:::.. .||||::|
 Frog   131 ATGGTMNAACELVKRRNAEILDCLVVIELKSLKGAQKIKPYTVHSLLQY 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AprtNP_001286908.1 PRK02304 9..182 CDD:235028 80/173 (46%)
aprtNP_001007941.1 PRK02304 5..180 CDD:235028 81/175 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6054
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H413
Inparanoid 1 1.050 154 1.000 Inparanoid score I4216
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1291050at2759
OrthoFinder 1 1.000 - - FOG0001975
OrthoInspector 1 1.000 - - oto102764
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R77
SonicParanoid 1 1.000 - - X1290
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.