DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aprt and APRT

DIOPT Version :9

Sequence 1:NP_001286908.1 Gene:Aprt / 48224 FlyBaseID:FBgn0000109 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_000476.1 Gene:APRT / 353 HGNCID:626 Length:180 Species:Homo sapiens


Alignment Length:178 Identity:82/178 - (46%)
Similarity:116/178 - (65%) Gaps:2/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AEDKLDYVKSKIGEYPNFPKEGILFRDIFGALTDPKACVYLRDLLVDHIRES-APEAEVIVGLDS 70
            |:.:|..|:.:|..:|:||..|::||||...|.||.:......||..|::.: ....:.|.||||
Human     2 ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDS 66

  Fly    71 RGFLFNLLIATELGLGCAPIRKKGKLAGEVVSVEYKLEYGIDTFELQKSAIKPGQKVVVVDDLLA 135
            |||||...:|.||||||..|||:|||.|..:...|.||||....|:||.|::|||:|||||||||
Human    67 RGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLA 131

  Fly   136 TGGSLVAATELIGKVGGVVVESLVVMELVGLEGRKRL-DGKVHSLIKY 182
            |||::.||.||:|::...|:|.:.::||..|:||::| .....||::|
Human   132 TGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQY 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AprtNP_001286908.1 PRK02304 9..182 CDD:235028 80/174 (46%)
APRTNP_000476.1 apt 9..179 CDD:273437 79/169 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152582
Domainoid 1 1.000 113 1.000 Domainoid score I6160
eggNOG 1 0.900 - - E1_COG0503
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H413
Inparanoid 1 1.050 151 1.000 Inparanoid score I4377
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62323
OrthoDB 1 1.010 - - D1291050at2759
OrthoFinder 1 1.000 - - FOG0001975
OrthoInspector 1 1.000 - - oto88900
orthoMCL 1 0.900 - - OOG6_101012
Panther 1 1.100 - - LDO PTHR32315
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R77
SonicParanoid 1 1.000 - - X1290
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.