DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aprt and Aprt

DIOPT Version :9

Sequence 1:NP_001286908.1 Gene:Aprt / 48224 FlyBaseID:FBgn0000109 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001013079.1 Gene:Aprt / 292072 RGDID:1307758 Length:180 Species:Rattus norvegicus


Alignment Length:179 Identity:86/179 - (48%)
Similarity:118/179 - (65%) Gaps:4/179 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AEDKLDYVKSKIGEYPNFPKEGILFRDIFGALTDPKACVYLRDLLVDHIRES-APEAEVIVGLDS 70
            :|.:|..|..:|..:|:||..|:|||||...|.||.:......||..|::.: ..:.:.|.||||
  Rat     2 SESELQLVARRIRSFPDFPIPGVLFRDISPLLKDPDSFRASIRLLAGHLKSTHGGKIDYIAGLDS 66

  Fly    71 RGFLFNLLIATELGLGCAPIRKKGKLAGEVVSVEYKLEYGIDTFELQKSAIKPGQKVVVVDDLLA 135
            |||||...:|.|||:||..|||:|||.|..||..|.||||....|:||.|::||||||:||||||
  Rat    67 RGFLFGPSLAQELGVGCVLIRKRGKLPGPTVSASYSLEYGKAELEIQKDALEPGQKVVIVDDLLA 131

  Fly   136 TGGSLVAATELIGKVGGVVVESLVVMELVGLEGRKRLDGKV--HSLIKY 182
            |||::.||.||:.::...|||.:.::||..|:||::| |.|  .||::|
  Rat   132 TGGTMCAACELLSQLRAEVVECVSLVELTSLKGREKL-GPVPFFSLLQY 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AprtNP_001286908.1 PRK02304 9..182 CDD:235028 84/175 (48%)
AprtNP_001013079.1 PRK02304 6..180 CDD:235028 85/175 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346102
Domainoid 1 1.000 117 1.000 Domainoid score I5796
eggNOG 1 0.900 - - E1_COG0503
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H413
Inparanoid 1 1.050 153 1.000 Inparanoid score I4261
OMA 1 1.010 - - QHG62323
OrthoDB 1 1.010 - - D1291050at2759
OrthoFinder 1 1.000 - - FOG0001975
OrthoInspector 1 1.000 - - oto96031
orthoMCL 1 0.900 - - OOG6_101012
Panther 1 1.100 - - LDO PTHR32315
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1290
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.