DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aprt and apt1

DIOPT Version :9

Sequence 1:NP_001286908.1 Gene:Aprt / 48224 FlyBaseID:FBgn0000109 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_594433.1 Gene:apt1 / 2542022 PomBaseID:SPAC23A1.03 Length:188 Species:Schizosaccharomyces pombe


Alignment Length:174 Identity:79/174 - (45%)
Similarity:119/174 - (68%) Gaps:0/174 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AEDKLDYVKSKIGEYPNFPKEGILFRDIFGALTDPKACVYLRDLLVDHIRESAPEAEVIVGLDSR 71
            ::|:::|:|:|:.:||:|||:||||.||.....||:|...|.|||::.:.......:|||||::|
pombe     2 SDDRINYLKNKLVQYPDFPKKGILFEDIMPIFQDPRAFGILIDLLLEAVETEFNNIDVIVGLEAR 66

  Fly    72 GFLFNLLIATELGLGCAPIRKKGKLAGEVVSVEYKLEYGIDTFELQKSAIKPGQKVVVVDDLLAT 136
            ||||...:|........|:||..||.|::|.|.|..||..|:|.:||..|||||:|::|||:|||
pombe    67 GFLFGPTLALRANCAFVPVRKPNKLPGDLVVVSYNKEYSTDSFAIQKGTIKPGQRVLIVDDILAT 131

  Fly   137 GGSLVAATELIGKVGGVVVESLVVMELVGLEGRKRLDGKVHSLI 180
            ||:.:||.||:.::||.:|..|.::||..|:|||||....::|:
pombe   132 GGTALAADELVTRLGGELVGHLFLLELTFLQGRKRLMAPTYTLL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AprtNP_001286908.1 PRK02304 9..182 CDD:235028 79/172 (46%)
apt1NP_594433.1 PRK02304 8..176 CDD:235028 78/168 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 105 1.000 Domainoid score I1705
eggNOG 1 0.900 - - E1_COG0503
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H413
Inparanoid 1 1.050 163 1.000 Inparanoid score I1224
OMA 1 1.010 - - QHG62323
OrthoFinder 1 1.000 - - FOG0001975
OrthoInspector 1 1.000 - - oto100727
orthoMCL 1 0.900 - - OOG6_101012
Panther 1 1.100 - - LDO PTHR32315
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R77
SonicParanoid 1 1.000 - - X1290
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.