DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aprt and Aprt

DIOPT Version :9

Sequence 1:NP_001286908.1 Gene:Aprt / 48224 FlyBaseID:FBgn0000109 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_033828.2 Gene:Aprt / 11821 MGIID:88061 Length:180 Species:Mus musculus


Alignment Length:179 Identity:84/179 - (46%)
Similarity:119/179 - (66%) Gaps:4/179 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AEDKLDYVKSKIGEYPNFPKEGILFRDIFGALTDPKACVYLRDLLVDHIRES-APEAEVIVGLDS 70
            :|.:|..|..:|..:|:||..|:|||||...|.||.:......||..|::.: :.:.:.|.||||
Mouse     2 SEPELKLVARRIRSFPDFPIPGVLFRDISPLLKDPDSFRASIRLLASHLKSTHSGKIDYIAGLDS 66

  Fly    71 RGFLFNLLIATELGLGCAPIRKKGKLAGEVVSVEYKLEYGIDTFELQKSAIKPGQKVVVVDDLLA 135
            |||||...:|.|||:||..|||:|||.|..||..|.||||....|:||.|::|||:||:||||||
Mouse    67 RGFLFGPSLAQELGVGCVLIRKQGKLPGPTVSASYSLEYGKAELEIQKDALEPGQRVVIVDDLLA 131

  Fly   136 TGGSLVAATELIGKVGGVVVESLVVMELVGLEGRKRLDGKV--HSLIKY 182
            |||::.||.:|:.::...|||.:.::||..|:||:|| |.:  .||::|
Mouse   132 TGGTMFAACDLLHQLRAEVVECVSLVELTSLKGRERL-GPIPFFSLLQY 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AprtNP_001286908.1 PRK02304 9..182 CDD:235028 82/175 (47%)
AprtNP_033828.2 PRK02304 6..180 CDD:235028 83/175 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842641
Domainoid 1 1.000 114 1.000 Domainoid score I6076
eggNOG 1 0.900 - - E1_COG0503
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H413
Inparanoid 1 1.050 151 1.000 Inparanoid score I4347
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62323
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001975
OrthoInspector 1 1.000 - - oto92466
orthoMCL 1 0.900 - - OOG6_101012
Panther 1 1.100 - - LDO PTHR32315
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1290
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.