DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NINJ1 and NijB

DIOPT Version :10

Sequence 1:NP_004139.2 Gene:NINJ1 / 4814 HGNCID:7824 Length:152 Species:Homo sapiens
Sequence 2:NP_649068.1 Gene:NijB / 40057 FlyBaseID:FBgn0036822 Length:181 Species:Drosophila melanogaster


Alignment Length:104 Identity:38/104 - (36%)
Similarity:65/104 - (62%) Gaps:9/104 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    39 NHYASKKSAAESMLDIALLMANASQLKAVVEQGPSFAFYVPLVVLISISLVLQIGVGVLLIF--- 100
            |.||:.|:.||.::|||||.|||:||:.::......:.|:..::::.:|||||:.||::|||   
  Fly    75 NSYAANKNVAEGLMDIALLSANANQLRFLITYNDKASTYIYSMIMVILSLVLQLLVGIMLIFKRR 139

Human   101 LVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAF 139
            |.::      ::...:..|:|....||:|.|:||.:.||
  Fly   140 LKRF------RNRSYERTNDLLVMGVFMITVINILLAAF 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NINJ1NP_004139.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
N-terminal adhesion motif. /evidence=ECO:0000269|PubMed:33028854 26..37
Ninjurin 38..139 CDD:461482 36/102 (35%)
Required to induce plasma membrane rupture. /evidence=ECO:0000250|UniProtKB:O70131 40..69 15/28 (54%)
Helix alpha1. /evidence=ECO:0000269|PubMed:37198476, ECO:0000269|PubMed:39667936, ECO:0007744|PDB:8SZA 44..55 4/10 (40%)
Helix alpha2. /evidence=ECO:0000269|PubMed:37198476, ECO:0000269|PubMed:39667936, ECO:0007744|PDB:8SZA 58..74 5/15 (33%)
NijBNP_649068.1 Ninjurin 75..172 CDD:461482 36/102 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.