DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNU13 and RpS12

DIOPT Version :9

Sequence 1:NP_001003796.1 Gene:SNU13 / 4809 HGNCID:7819 Length:128 Species:Homo sapiens
Sequence 2:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster


Alignment Length:117 Identity:28/117 - (23%)
Similarity:52/117 - (44%) Gaps:11/117 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTEADVN-PKAYPLADA--HLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEP 62
            |.:.||: |.|.|:.|.  .:...|.:::::|.....|..|.::|.|.|::..:...::|...:.
  Fly     1 MADVDVDVPSAAPVLDGAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDE 65

Human    63 LEIILHLPLLCEDKNVPYVFVRSKQALGRACGV--------SRPVIACSVTI 106
            ......:..||.:..:|.:.|.|.:.||...|:        .|.|..|||.:
  Fly    66 PNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVV 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNU13NP_001003796.1 SNU13 7..128 CDD:411046 25/111 (23%)
Interaction with U4 snRNA and U4atac snRNA. /evidence=ECO:0000269|PubMed:17412961, ECO:0000269|PubMed:21784869 36..48 4/11 (36%)
Important for U4 snRNA-binding. /evidence=ECO:0000269|PubMed:10545122 96..128 5/11 (45%)
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 21/95 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.