powered by:
Protein Alignment NHLH2 and sc
DIOPT Version :9
Sequence 1: | XP_016856859.1 |
Gene: | NHLH2 / 4808 |
HGNCID: | 7818 |
Length: | 240 |
Species: | Homo sapiens |
Sequence 2: | NP_476803.1 |
Gene: | sc / 30982 |
FlyBaseID: | FBgn0004170 |
Length: | 345 |
Species: | Drosophila melanogaster |
Alignment Length: | 57 |
Identity: | 17/57 - (29%) |
Similarity: | 25/57 - (43%) |
Gaps: | 14/57 - (24%) |
- Green bases have known domain annotations that are detailed below.
Human 122 GGRRNSAVGIWPEEAQKPSRDPTGLRLFPRPRATGPLWPSASRGVQSSMRPGSTASP 178
||.:|...|..|.:.:|.: |.|:.| ...|..| ||:.|||:.:|
Fly 50 GGNQNQPAGTMPIKTRKYT--PRGMAL-----------TRCSESV-SSLSPGSSPAP 92
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
NHLH2 | XP_016856859.1 |
None |
sc | NP_476803.1 |
HLH |
105..163 |
CDD:278439 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.