DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)12 and cope-1

DIOPT Version :9

Sequence 1:NP_730465.1 Gene:Su(z)12 / 48071 FlyBaseID:FBgn0020887 Length:900 Species:Drosophila melanogaster
Sequence 2:NP_499771.1 Gene:cope-1 / 176766 WormBaseID:WBGene00009732 Length:292 Species:Caenorhabditis elegans


Alignment Length:163 Identity:38/163 - (23%)
Similarity:60/163 - (36%) Gaps:54/163 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QQEQELFL--------QAF----EKP--------TQIYRYLRNRHETNPIFLNRTLSYMKERM-S 95
            :||::::|        |||    |.|        ..:.||...|:  ||....:.|:.::|.: |
 Worm    35 KQEKDVYLYRSYIAQGQAFIPLKEIPAATKSADLAAVRRYAEFRN--NPAAKKKILAEVQEEVAS 97

  Fly    96 RNNKKRISFQVNSMLESITQKSEAVSQNYLHVIYDSLHEKLPARLD------------------- 141
            ||.|..|:    ::|.:.......:||:....:  |..|.|.||..                   
 Worm    98 RNIKSEIA----AVLAATILNEADLSQDAFRAV--SRFEGLEARASKVFILIKMNKRKLAIGEVK 156

  Fly   142 --NESGEDL----LQEQLLCEAGESVSVETTLY 168
              |:..||.    |...|:...|.|..|:..||
 Worm   157 KMNQIDEDATLSQLANALVTSFGASGKVKDALY 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)12NP_730465.1 VEFS-Box 511..644 CDD:286776
cope-1NP_499771.1 Coatomer_E 3..291 CDD:252768 38/163 (23%)
PPR repeat 172..197 CDD:276811 6/18 (33%)
PPR repeat 204..231 CDD:276811
PPR repeat 238..264 CDD:276811
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.831874 Normalized mean entropy S3651
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.