DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rin and AT3G55540

DIOPT Version :9

Sequence 1:NP_524907.2 Gene:rin / 47998 FlyBaseID:FBgn0015778 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_191113.1 Gene:AT3G55540 / 824719 AraportID:AT3G55540 Length:334 Species:Arabidopsis thaliana


Alignment Length:160 Identity:38/160 - (23%)
Similarity:71/160 - (44%) Gaps:12/160 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MDATQSQQPSPQSVGREFVRQYYTLLNKAPNHLHRFYNHNS-----SYIHGESKL-VVGQREIHN 61
            :|:..:....|:|.|  ||:.||.|..:  ..|...|.:.|     :...|.:.: :.|...|:.
plant   155 IDSIPALPSVPESAG--FVKVYYELPMR--EELGLMYVNESIMSRPTSTSGRTMVEMPGLDAINK 215

  Fly    62 RIQQLNFNDCHAKISQVDAQ--ATLGNGVVVQVTGELSNDGQPMRRFTQTFVLAAQSPKKYYVHN 124
            |:...:....:..::.||.|  .:..:.:.:.|.|.::.|.:..|:|.|.|.:.......|.::|
plant   216 RVSNEHKRASNFILNSVDYQISRSFKDRMFIMVCGFVTLDDKTERKFLQFFYVTRCHNGSYVIYN 280

  Fly   125 DIFRYQDLYIEDEQDGESRSENDEEHDVQV 154
            ||.||.|:...|..:..|:|......||::
plant   281 DILRYVDVTPRDTLESSSQSAAKPSTDVEL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rinNP_524907.2 NTF2 12..131 CDD:238403 31/126 (25%)
RRM 423..>557 CDD:223796
RRM_G3BP 490..580 CDD:240675
AT3G55540NP_191113.1 NTF2 32..154 CDD:396625
NTF2 167..287 CDD:238403 30/123 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000749
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10693
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.