DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NFKBIA and mask

DIOPT Version :10

Sequence 1:NP_065390.1 Gene:NFKBIA / 4792 HGNCID:7797 Length:317 Species:Homo sapiens
Sequence 2:NP_001247280.1 Gene:mask / 50070 FlyBaseID:FBgn0043884 Length:4010 Species:Drosophila melanogaster


Alignment Length:273 Identity:73/273 - (26%)
Similarity:114/273 - (41%) Gaps:45/273 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    27 DDRHDSGLDSMKDEEYEQMVKEL--QEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKAL 89
            :..||:.|.......:|::|:.|  :...:|.:: .:|..|.....|...|..:.:.:.|.    
  Fly  2319 ESNHDTALTLACAGGHEELVELLINRGANIEHRD-KKGFTPLILAATAGHDKVVDILLKHS---- 2378

Human    90 TMEVIRQVKGDLAFLNFQN-NLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACE 153
                        |.|..|: ..:.|||.||....:.|:.|.||..|.:.|.|:....|||.||..
  Fly  2379 ------------AELEAQSERTKDTPLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLSLAAS 2431

Human   154 QG------CLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQ 212
            .|      .|.|.|....|.|...|          |.:.|.||:::|:...|:||:..|:|:|||
  Fly  2432 GGYVNIIKLLLSHGAEINSRTGSKL----------GISPLMLAAMNGHTPAVKLLLDQGSDINAQ 2486

Human   213 EPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLE-- 275
            ...|..|||.||......::|||||...|:|......|.:|..    ..::....::|::.|:  
  Fly  2487 IETNRNTALTLACFQGRHEVVSLLLDRRANVEHRAKTGLTPLM----EAASGGYIEVGRVLLDKG 2547

Human   276 ---NLQMLPESED 285
               |...:|.|.|
  Fly  2548 ADVNAAPVPTSRD 2560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NFKBIANP_065390.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 3/11 (27%)
Destruction motif. /evidence=ECO:0000269|PubMed:8657102 30..36 3/5 (60%)
Nuclear export signal. /evidence=ECO:0000269|PubMed:10655476 45..54 2/10 (20%)
ANK repeat 73..108 CDD:293786 4/34 (12%)
ANK 1 73..103 2/29 (7%)
ANKYR 75..>256 CDD:440430 57/187 (30%)
ANK repeat 110..141 CDD:293786 11/30 (37%)
ANK 2 110..139 10/28 (36%)
Nuclear import signal. /evidence=ECO:0000269|PubMed:9566872 110..120 5/9 (56%)
ANK repeat 143..180 CDD:293786 12/42 (29%)
ANK 3 143..172 11/34 (32%)
ANK repeat 182..213 CDD:293786 12/30 (40%)
ANK 4 182..211 10/28 (36%)
ANK repeat 216..246 CDD:293786 13/29 (45%)
ANK 5 216..245 13/28 (46%)
maskNP_001247280.1 ANKYR 584..858 CDD:440430
ANK repeat 596..628 CDD:293786
ANK repeat 633..661 CDD:293786
ANK repeat 663..694 CDD:293786
ANK repeat 696..724 CDD:293786
ANK repeat 730..760 CDD:293786
ANKYR 744..1062 CDD:440430
ANK repeat 765..794 CDD:293786
ANK repeat 796..827 CDD:293786
ANK repeat 829..858 CDD:293786
ANK repeat 862..894 CDD:293786
ANK repeat 896..923 CDD:293786
ANK repeat 927..957 CDD:293786
ANK repeat 959..991 CDD:293786
ANK repeat 993..1023 CDD:293786
ANK 2321..2349 CDD:197603 6/27 (22%)
ANK repeat 2323..2352 CDD:293786 6/28 (21%)
ANKYR 2336..2623 CDD:440430 69/256 (27%)
ANK repeat 2354..2386 CDD:293786 8/47 (17%)
ANK repeat 2390..2419 CDD:293786 11/28 (39%)
ANK repeat 2421..2452 CDD:293786 10/30 (33%)
ANK repeat 2456..2486 CDD:293786 12/39 (31%)
ANK repeat 2492..2521 CDD:293786 12/28 (43%)
ANK repeat 2523..2589 CDD:293786 8/42 (19%)
ANK repeat 2560..2587 CDD:293786 1/1 (100%)
ANK repeat 2591..2622 CDD:293786
KH-I_MASK 3047..3116 CDD:411832
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.