DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NFKBIA and cact

DIOPT Version :10

Sequence 1:NP_065390.1 Gene:NFKBIA / 4792 HGNCID:7797 Length:317 Species:Homo sapiens
Sequence 2:NP_476942.1 Gene:cact / 34969 FlyBaseID:FBgn0000250 Length:500 Species:Drosophila melanogaster


Alignment Length:277 Identity:98/277 - (35%)
Similarity:136/277 - (49%) Gaps:38/277 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    66 WKQ--QLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAE 128
            |:|  |..:|||:.||||.|.....:...:||..... ..||.||::.|||||||.:|.||.|..
  Fly   220 WEQFYQQNDDGDTPLHLACISGSVDVVAALIRMAPHP-CLLNIQNDVAQTPLHLAALTAQPNIMR 283

Human   129 ALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSI------------------ 175
            .||.||.:|.:||..|||.|||:|..|....|..||:......:|..                  
  Fly   284 ILLLAGAEPTVRDRHGNTALHLSCIAGEKQCVRALTEKFGATEIHEAHRQYGHRSNDKAVSSLSY 348

Human   176 ------LKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVS 234
                  |:..||:|..|:|||:..|::.|:.:|||.|||:||:|..:|||.||:|::..|.||.:
  Fly   349 ACLPADLEIRNYDGERCVHLAAEAGHIDILRILVSHGADINAREGKSGRTPLHIAIEGCNEDLAN 413

Human   235 LLL-KC-GADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTE 297
            .|| :| ..::...||.|.:.||.......:|:|..|.:...|.  :.|...|.:|.|.|.    
  Fly   414 FLLDECEKLNLETATYAGLTAYQFACIMNKSRMQNILEKRGAET--VTPPDSDYDSSDIED---- 472

Human   298 FTEDELPYDDCVFGGQR 314
             .:|...||.  ||..|
  Fly   473 -LDDTKMYDR--FGDPR 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NFKBIANP_065390.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
Destruction motif. /evidence=ECO:0000269|PubMed:8657102 30..36
Nuclear export signal. /evidence=ECO:0000269|PubMed:10655476 45..54
ANK repeat 73..108 CDD:293786 12/34 (35%)
ANK 1 73..103 10/29 (34%)
ANKYR 75..>256 CDD:440430 77/206 (37%)
ANK repeat 110..141 CDD:293786 16/30 (53%)
ANK 2 110..139 16/28 (57%)
Nuclear import signal. /evidence=ECO:0000269|PubMed:9566872 110..120 7/9 (78%)
ANK repeat 143..180 CDD:293786 13/60 (22%)
ANK 3 143..172 11/28 (39%)
ANK repeat 182..213 CDD:293786 15/30 (50%)
ANK 4 182..211 13/28 (46%)
ANK repeat 216..246 CDD:293786 12/31 (39%)
ANK 5 216..245 12/30 (40%)
cactNP_476942.1 ANKYR <225..464 CDD:440430 86/241 (36%)
ANK repeat 229..263 CDD:293786 12/34 (35%)
ANK repeat 265..296 CDD:293786 16/30 (53%)
ANK repeat 298..324 CDD:293786 11/25 (44%)
ANK repeat 361..393 CDD:293786 15/31 (48%)
ANK repeat 395..425 CDD:293786 12/29 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.