DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)03659 and NAP5

DIOPT Version :9

Sequence 1:NP_001260823.1 Gene:l(2)03659 / 47905 FlyBaseID:FBgn0010549 Length:1374 Species:Drosophila melanogaster
Sequence 2:NP_177289.1 Gene:NAP5 / 843474 AraportID:AT1G71330 Length:324 Species:Arabidopsis thaliana


Alignment Length:328 Identity:100/328 - (30%)
Similarity:164/328 - (50%) Gaps:46/328 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   588 MDSQRYEEVVKKCALERDFDLLPLRDNTIVGERGATLSGGQKARISLARSVYRKASIYLLDDPLS 652
            ||.:||::|::.|:|.:|.::|...|.|::||||..||||||.||.:||::|:.|.|||.|||.|
plant     1 MDRERYDKVIEACSLSKDLEILSFGDQTVIGERGINLSGGQKQRIHIARALYQDADIYLFDDPFS 65

  Fly   653 AVDASVARHLFDQCVRGHLRGSTVVLVTHQEQFLPHVDQIVILANGQIKALGDYESLLKTG---- 713
            ||||....|||.:.:||.|...:|:.||||.:|||..|..:::.:|:|...|.|..:|.:|    
plant    66 AVDAHTGSHLFKEALRGLLCSKSVIYVTHQVEFLPSADLTLVMKDGRISQAGKYNDILISGTDFR 130

  Fly   714 -LI----TGLGSLSKTDKAKTEEQEPLNLNSP--------DNKNEVTPIKENSEQTVGGSSSGKE 765
             ||    ..|..:...|.:...|...|:..:.        |.|.|...:|.:.   :......::
plant   131 ELIGAHQESLAVVGSADASSVSENSALDEENGVVRDDIGFDGKQESQDLKNDK---LDSGEPQRQ 192

  Fly   766 HVERQE--SGGISLALYRKYFQA--GGGLVAFLVMLSSSVLAQVAVTGGDYFLTYWVKKESTAAG 826
            .|:.:|  .|.::|.:|.||...  ||.||.|:::  ..:|.|:...|.:|::. |....|    
plant   193 FVQEEERAKGSVALDVYWKYITLAYGGALVPFILL--GQILFQLLQIGSNYWMA-WATPIS---- 250

  Fly   827 HGEMEDMESKSMDVYKYTLIIILSVIMNLSSSF-------LLFNIAKKASIRLHNTIFNRVTRAD 884
                ||:::.    .|.:.::::.|.:...||.       ||.....|.:..|.:.:.:.:.|:.
plant   251 ----EDVQAP----VKLSTLMVVYVALAFGSSLCILVRATLLVTAGYKTATELFHKMHHCIFRSP 307

  Fly   885 MHF 887
            |.|
plant   308 MSF 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)03659NP_001260823.1 CFTR_protein 89..1343 CDD:273530 100/328 (30%)
ABC_membrane 171..437 CDD:294371
ABCC_MRP_domain1 499..699 CDD:213217 53/110 (48%)
ABC_membrane 799..1045 CDD:294371 19/96 (20%)
ABCC_MRP_domain2 1115..1336 CDD:213211
NAP5NP_177289.1 P-loop_NTPase <1..112 CDD:304359 53/110 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138195at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.