DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)03659 and LOC110439293

DIOPT Version :9

Sequence 1:NP_001260823.1 Gene:l(2)03659 / 47905 FlyBaseID:FBgn0010549 Length:1374 Species:Drosophila melanogaster
Sequence 2:XP_021330365.1 Gene:LOC110439293 / 110439293 -ID:- Length:174 Species:Danio rerio


Alignment Length:100 Identity:21/100 - (21%)
Similarity:39/100 - (39%) Gaps:35/100 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   935 VNPLLLVPTLMLSVIFYHLRNLYLKTSRDLKRVEAINRSPVYSHL---AASLNGLTTIRALDAQR 996
            ::|::...|::|:::..||..|     |..       ||.::..|   .|.:..|..:|| :.|.
Zfish   106 LSPIIRSLTMILAMLMIHLERL-----RGF-------RSSMFLFLFWMLAVVCSLVPLRA-NIQA 157

  Fly   997 VLEKEFDSYQDAHSSAFFMYISTSQAFGYCMNCIC 1031
            ::|:                :.||....   ||.|
Zfish   158 IIEE----------------VCTSTLLS---NCCC 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)03659NP_001260823.1 CFTR_protein 89..1343 CDD:273530 20/99 (20%)
ABC_membrane 171..437 CDD:294371
ABCC_MRP_domain1 499..699 CDD:213217
ABC_membrane 799..1045 CDD:294371 20/99 (20%)
ABCC_MRP_domain2 1115..1336 CDD:213211
LOC110439293XP_021330365.1 SunT 5..>161 CDD:331423 15/67 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586088
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.