DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and PRSS27

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_114154.1 Gene:PRSS27 / 83886 HGNCID:15475 Length:290 Species:Homo sapiens


Alignment Length:275 Identity:93/275 - (33%)
Similarity:145/275 - (52%) Gaps:42/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LILL--------SAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIY 61
            |:||        :|.||.         .|::..|:|||..|....:|||:|:||:|||.||||:.
Human    10 LLLLCFGSQRAKAATACG---------RPRMLNRMVGGQDTQEGEWPWQVSIQRNGSHFCGGSLI 65

  Fly    62 SARVIVTAAHCLQSVSASSL-QIRAGSSYWSSGG---VVAKVSSFKNHEGYNANTMVNDIAVLHL 122
            :.:.::|||||.::.|.:|| |:..|:......|   :.|:|...:::..|.......|:|::.|
Human    66 AEQWVLTAAHCFRNTSETSLYQVLLGARQLVQPGPHAMYARVRQVESNPLYQGTASSADVALVEL 130

  Fly   123 SSSLSFSSTIKAIGLASSNPA----NGAAASVSGWGTESSGSSSIPSQ--LRYVNVNIVSQSRCS 181
            .:.:.|::.|..:.|  .:|:    .|....|:|||:.|. ...:|..  |:.:.|.|:...:|:
Human   131 EAPVPFTNYILPVCL--PDPSVIFETGMNCWVTGWGSPSE-EDLLPEPRILQKLAVPIIDTPKCN 192

  Fly   182 -----SSSYGY-GNQIKSSMICA-FASG-KDSCQGDSGGPLV----SGGVLVGVVSWGYGCAAAN 234
                 .:.:|| ...||:.|:|| |..| ||:|:||||||||    ...:..||:|||.|||..|
Human   193 LLYSKDTEFGYQPKTIKNDMLCAGFEEGKKDACKGDSGGPLVCLVGQSWLQAGVISWGEGCARQN 257

  Fly   235 YPGVYADVAALRSWV 249
            .||||..|.|..:|:
Human   258 RPGVYIRVTAHHNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 85/240 (35%)
Tryp_SPc 31..252 CDD:238113 85/241 (35%)
PRSS27NP_114154.1 Tryp_SPc 34..272 CDD:214473 85/240 (35%)
Tryp_SPc 36..275 CDD:238113 85/240 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4288
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.