DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Prss8

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:276 Identity:96/276 - (34%)
Similarity:140/276 - (50%) Gaps:43/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LILLSAVACALGGTIPEGLLPQLDG-----------RIVGGTATTISSFPWQISLQRSGSHSCGG 58
            |:||        |.:..|:  :.||           ||.||.:.....:|||:|:...|:|.|||
Mouse    18 LLLL--------GLLQSGI--RADGTEASCGAVIQPRITGGGSAKPGQWPWQVSITYDGNHVCGG 72

  Fly    59 SIYSARVIVTAAHCL-QSVSASSLQIRAGS----SYWSSGGVVAKVSSFKNHEGYNANTMVNDIA 118
            |:.|.:.:|:||||. :..|..:.:::.|:    || |:..||..|:....|..|.......|||
Mouse    73 SLVSNKWVVSAAHCFPREHSREAYEVKLGAHQLDSY-SNDTVVHTVAQIITHSSYREEGSQGDIA 136

  Fly   119 VLHLSSSLSFSSTIKAIGLASSNPA--NGAAASVSGWG-TESSGSSSIPSQLRYVNVNIVSQSRC 180
            ::.|||.::||..|:.|.|.::|.:  ||...:|:||| ...|.|...|..|:.:.|.::|:..|
Mouse   137 LIRLSSPVTFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETC 201

  Fly   181 SSSSYGYG------NQIKSSMICA--FASGKDSCQGDSGGPL---VSG-GVLVGVVSWGYGCAAA 233
             |..|...      :.|:..|:||  ...|||:|||||||||   :.| ..|.|:||||..|.|.
Mouse   202 -SCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPMEGIWYLAGIVSWGDACGAP 265

  Fly   234 NYPGVYADVAALRSWV 249
            |.||||...:...||:
Mouse   266 NRPGVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 88/238 (37%)
Tryp_SPc 31..252 CDD:238113 88/239 (37%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 88/239 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.