DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and TPSAB1

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:271 Identity:92/271 - (33%)
Similarity:130/271 - (47%) Gaps:26/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFLILLSAVACALGGTIP-EGLLPQLDGRIVGGTATTISSFPWQISLQRSG---SHSCGGSIY 61
            ||..|:|...|..:.....| .|...|..| ||||.....|.:|||:||:..|   .|.||||:.
Human     1 MLNLLLLALPVLASRAYAAPAPGQALQRVG-IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLI 64

  Fly    62 SARVIVTAAHC----LQSVSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHL 122
            ..:.::|||||    ::.::|..:|:|....|:..  .:..||....|..:....:..|||:|.|
Human    65 HPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQD--QLLPVSRIIVHPQFYTAQIGADIALLEL 127

  Fly   123 SSSLSFSSTIKAIGL--ASSNPANGAAASVSGWG-TESSGSSSIPSQLRYVNVNIVSQSRCSSSS 184
            ...::.||.:..:.|  ||.....|....|:||| .::......|..|:.|.|.|:....| .:.
Human   128 EEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHIC-DAK 191

  Fly   185 YGYG-------NQIKSSMICAFASGKDSCQGDSGGPL---VSGGVL-VGVVSWGYGCAAANYPGV 238
            |..|       ..::..|:||..:.:|||||||||||   |:|..| .||||||.|||..|.||:
Human   192 YHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGI 256

  Fly   239 YADVAALRSWV 249
            |..|.....|:
Human   257 YTRVTYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 82/239 (34%)
Tryp_SPc 31..252 CDD:238113 83/240 (35%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 83/240 (35%)
Tryp_SPc 31..267 CDD:214473 82/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4288
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.