DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and LOC683849

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:253 Identity:90/253 - (35%)
Similarity:136/253 - (53%) Gaps:25/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTA 69
            |::|:.|..|:...:.:      |.:||||.....:|.|:|:|| .||.|.||||:.:.:.:|:|
  Rat     4 LLILALVGTAVAFPVDD------DDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSA 61

  Fly    70 AHCLQSVSASSLQIRAGSSYWSSGGVVAKVSSFKN------HEGYNANTMVNDIAVLHLSSSLSF 128
            |||.:    |.:|:|.|.   .:..|:.....|.|      |..::..|:.|||.::.|||.:..
  Rat    62 AHCYK----SRIQVRLGE---HNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKL 119

  Fly   129 SSTIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIKS 193
            ::.:..:.|.||....|....:||||...|...:.|..|:.::..::.|:.|.:|   |..:|..
  Rat   120 NARVATVALPSSCAPAGTQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADCEAS---YPGKITD 181

  Fly   194 SMICA--FASGKDSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVYADVAALRSWV 249
            :|:||  ...||||||||||||:|..|.|.|:||||||||..:.||||..|.....|:
  Rat   182 NMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 84/226 (37%)
Tryp_SPc 31..252 CDD:238113 85/227 (37%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 84/226 (37%)
Tryp_SPc 24..242 CDD:238113 85/227 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.