DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Prss41

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001128559.1 Gene:Prss41 / 681033 RGDID:1584711 Length:324 Species:Rattus norvegicus


Alignment Length:295 Identity:86/295 - (29%)
Similarity:130/295 - (44%) Gaps:61/295 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LILLSAVACALGG---------------------TIPEGLLPQLDGRIVGGTATTISSFPWQISL 48
            |:||..|.|.:.|                     ::|.|....:..|||||..:....:|||.||
  Rat     8 LLLLLLVVCVMLGEPGSREENQAAGLKNTDIKLLSMPCGRRNDIRSRIVGGIESVRGRWPWQASL 72

  Fly    49 QRSGSHSCGGSIYSARVIVTAAHCLQSVSASSLQIRAGSSYWS-SGGVVAKVSSFKNHEGYNANT 112
            :....|.||||:.|.|.::|||||.:..        .....|: ..|.:....||.|.|.::...
  Rat    73 RLRKFHRCGGSLLSHRWVLTAAHCFRKF--------LDPKKWTVQLGQLTSKPSFWNREAFSGRY 129

  Fly   113 MVNDI-------------AVLHLSSSLSFSSTIKAIGL--ASSNPANGAAASVSGWGTESSGSSS 162
            .|.||             |:|.|:||::::..|:.:.:  ::|...:.....|:|||........
  Rat   130 RVKDIIINSEDKLKYHDLALLRLASSVTYNKFIQPVCVLPSASMSQHQPRCWVTGWGALQEDLKP 194

  Fly   163 IPS--QLRYVNVNIVSQSRCS-----SSSYGYGNQIKSSMICAFA--SGKDSCQGDSGGPLVSG- 217
            :|.  .||.|.|.:::.|||.     :|.|   :.|...:.||.|  ...|:|.||||||||.. 
  Rat   195 LPPPYHLREVQVTVLNLSRCQELFSFASRY---HLITRDVFCAGAEDGSADTCSGDSGGPLVCNM 256

  Fly   218 -GV--LVGVVSWGYGCAAANYPGVYADVAALRSWV 249
             |:  .:|:||.|.||.....||:|.:|:....|:
  Rat   257 DGLWYQIGIVSRGVGCGRPKLPGIYTNVSHHYDWI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 77/247 (31%)
Tryp_SPc 31..252 CDD:238113 77/248 (31%)
Prss41NP_001128559.1 Tryp_SPc 54..291 CDD:214473 77/247 (31%)
Tryp_SPc 55..292 CDD:238113 77/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.