DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and CG17234

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:257 Identity:96/257 - (37%)
Similarity:139/257 - (54%) Gaps:26/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVT 68
            ||:||:.      ..:..|.:.:.:.||:||....|...|||:|||..|.|.|||||||..:|||
  Fly     6 FLLLLAL------DFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVT 64

  Fly    69 AAHCLQSVSASSL-----QIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSSLSF 128
            ||||......:.|     |:||||:...|.|.:..|::...||.|..:..:||||::.||:.|.|
  Fly    65 AAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEF 129

  Fly   129 SSTIKAIGLASSNPANGAAASVSGWGTE---SSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQ 190
            :|.::.|.||.:||...:.|.|||||..   :..::..|:.|:.:.::|.|...|        ..
  Fly   130 TSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC--------RL 186

  Fly   191 IKSSMICAFASGKDSCQGDSGGPLVSGGVLVGVVSWG-YGCAAANYPGVYADVAALRSWVIN 251
            ...|::||...|:.:|.||||||||....|||||||| .||.::.:   :..|...|.|::|
  Fly   187 FDPSLLCAGTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWILN 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 89/227 (39%)
Tryp_SPc 31..252 CDD:238113 90/230 (39%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 89/227 (39%)
Tryp_SPc 27..243 CDD:238113 88/226 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443197
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.