DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:255 Identity:91/255 - (35%)
Similarity:131/255 - (51%) Gaps:34/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTAAHCLQSVSASSLQIRAGSSY 89
            |.|:.|||||...|..::||.:|||....|.||||:.:.:.::|||||:...:.||:.:..|.  
Zfish    30 PTLNPRIVGGVNATHGAWPWMVSLQGRYGHFCGGSLINNQWVLTAAHCIVDQTPSSIIVYLGK-- 92

  Fly    90 WSSGGVVAKVSSFKN-------HEGYNANTMVNDIAVLHLSSSLSFSSTIKAIGLA--SSNPANG 145
            |.|  .||.|:|...       |..|:..|..||||:|.|:|::.::..||.|.||  :||...|
Zfish    93 WRS--YVADVNSISRTIRHIIPHPSYSNITKDNDIALLQLTSTVQYTDYIKPICLADENSNFPRG 155

  Fly   146 AAASVSGWG-------------TESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIKSSMIC 197
            ..:.|:|||             |..|.....|..|:...:.:.|.:.|::..:|   :|..:|||
Zfish   156 TNSWVAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQEAELKVYSNADCNNICHG---RITPNMIC 217

  Fly   198 AFA--SGKDSCQGDSGGPLV---SGGVLVGVVSWGYGCAAANYPGVYADVAALRSWVINN 252
            |..  .||.:..|||||||:   |..|..||:|.|||||..|.|.|:..|:..:.|:..|
Zfish   218 AGTRPGGKATFSGDSGGPLMTKCSVWVQAGVLSHGYGCAQPNLPEVFIRVSEYKQWITGN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 87/245 (36%)
Tryp_SPc 31..252 CDD:238113 87/247 (35%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 86/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.