DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Klk4

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_064312.1 Gene:Klk4 / 56640 MGIID:1861379 Length:255 Species:Mus musculus


Alignment Length:229 Identity:76/229 - (33%)
Similarity:113/229 - (49%) Gaps:14/229 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTAAHCLQS--VSASSLQIRAGSSY 89
            :..||:.|...:..|.|||.:|.......|.|.:...:.:::||||||.  :....|....||..
Mouse    28 VSSRIIQGQDCSPHSQPWQAALFSEDGFFCSGVLVHPQWVLSAAHCLQESYIVGLGLHNLKGSQE 92

  Fly    90 WSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSSLSFSSTIKAIGLASSNPANGAAASVSGWG 154
            ..|..:.|.:|.  .|..:|..:..||:.::.|:.|:..|:||::|.:|:..|..|....|||||
Mouse    93 PGSRMLEAHLSI--QHPNFNDPSFANDLMLIKLNESVIESNTIRSIPVATQCPTPGDTCLVSGWG 155

  Fly   155 TESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIKSSMICAFASG---KDSCQGDSGGPLVS 216
            ...:|  .:||.|:.||:::.|:..|...   |......||.|| ..|   ||||.||||||:|.
Mouse   156 QLKNG--KLPSLLQCVNLSVASEETCRLL---YDPVYHLSMFCA-GGGQDQKDSCNGDSGGPIVC 214

  Fly   217 GGVLVGVVSWGYG-CAAANYPGVYADVAALRSWV 249
            ...|.|:||.|.| |.....|.||.::....:|:
Mouse   215 NRSLQGLVSMGQGKCGQPGIPSVYTNLCKFTNWI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 75/224 (33%)
Tryp_SPc 31..252 CDD:238113 75/225 (33%)
Klk4NP_064312.1 Tryp_SPc 32..251 CDD:238113 75/225 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.