DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and PRTN3

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:265 Identity:76/265 - (28%)
Similarity:119/265 - (44%) Gaps:59/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQ---RSGSHSCGGSIYSARVIV 67
            :|||..|.|              ..||||......|.|:..|||   ..|||.|||::.....::
Human    17 LLLSGAARA--------------AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVL 67

  Fly    68 TAAHCLQSVSASSLQIRAGS----------SYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHL 122
            ||||||:.:....:.:..|:          .::|    ||:|  |.|:  |:|...:||:.::.|
Human    68 TAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFS----VAQV--FLNN--YDAENKLNDVLLIQL 124

  Fly   123 SSSLSFSSTIKAIGLASSNP--ANGAAASVSGWGTESSGSSSIPSQ-LRYVNVNIVSQSRCSSSS 184
            ||..:.|:::..:.|...:.  .:|......|||  ..|:...|:| |:.:||.:|: ..|    
Human   125 SSPANLSASVATVQLPQQDQPVPHGTQCLAMGWG--RVGAHDPPAQVLQELNVTVVT-FFC---- 182

  Fly   185 YGYGNQIKSSMICAFASGKDS--CQGDSGGPLVSGGVLVGV---VSWGYGCAAANYPGVYADVAA 244
                   :...||.|...:.:  |.|||||||:..|::.|:   |.|  |||...:|..:..||.
Human   183 -------RPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIW--GCATRLFPDFFTRVAL 238

  Fly   245 LRSWV 249
            ...|:
Human   239 YVDWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 70/239 (29%)
Tryp_SPc 31..252 CDD:238113 71/240 (30%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 71/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.