DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and PRSS2

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:270 Identity:97/270 - (35%)
Similarity:143/270 - (52%) Gaps:39/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFLILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVI 66
            :..|::|:.||.|:.....:      |.:||||.....:|.|:|:|| .||.|.||||:.|.:.:
Human     1 MNLLLILTFVAAAVAAPFDD------DDKIVGGYICEENSVPYQVSL-NSGYHFCGGSLISEQWV 58

  Fly    67 VTAAHCLQSVSASSL----------QIRAG----------SSYWSSGGVVAKVSSFKNHEGYNAN 111
            |:|.||.:|...|.|          |:|.|          ..:.::..::       .|..||:.
Human    59 VSAGHCYKSAINSKLSGRGCEYHRIQVRLGEHNIEVLEGNEQFINAAKII-------RHPKYNSR 116

  Fly   112 TMVNDIAVLHLSSSLSFSSTIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVS 176
            |:.|||.::.|||....:|.:.||.|.::.||.|..:.:||||...|..:..|.:|:.::..::|
Human   117 TLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLS 181

  Fly   177 QSRCSSSSYGYGNQIKSSMICA--FASGKDSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVY 239
            |:.|.:|   |..:|.::|.|.  ...||||||||||||:||.|.|.|:||||||||..|.||||
Human   182 QAECEAS---YPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVY 243

  Fly   240 ADVAALRSWV 249
            ..|.....|:
Human   244 TKVYNYVDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 90/240 (38%)
Tryp_SPc 31..252 CDD:238113 91/241 (38%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 90/240 (38%)
Tryp_SPc 24..256 CDD:238113 91/241 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.