DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and PRSS1

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:254 Identity:91/254 - (35%)
Similarity:140/254 - (55%) Gaps:23/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTA 69
            |::|:.||.||.....:      |.:||||.....:|.|:|:|| .||.|.||||:.:.:.:|:|
Human   229 LLILTFVAAALAAPFDD------DDKIVGGYNCEENSVPYQVSL-NSGYHFCGGSLINEQWVVSA 286

  Fly    70 AHCLQS-----VSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSSLSFS 129
            .||.:|     :...::::..|:..:.:...:.:      |..|:..|:.|||.::.|||....:
Human   287 GHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIR------HPQYDRKTLNNDIMLIKLSSRAVIN 345

  Fly   130 STIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIKSS 194
            :.:..|.|.::.||.|....:||||..:|..:..|.:|:.::..::||::|.:|   |..:|.|:
Human   346 ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEAS---YPGKITSN 407

  Fly   195 MICA--FASGKDSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVYADVAALRSWVIN 251
            |.|.  ...||||||||||||:|..|.|.||||||.|||..|.||||..|.....|:.|
Human   408 MFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKN 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 82/225 (36%)
Tryp_SPc 31..252 CDD:238113 84/228 (37%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 82/225 (36%)
Tryp_SPc 249..467 CDD:238113 84/228 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.