DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and KLK15

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:263 Identity:86/263 - (32%)
Similarity:126/263 - (47%) Gaps:36/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVACALGGTIPEGLLPQLDG-RIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTAA 70
            ||..::..|..|..:      || :::.|......|.|||::|...|..:||.|:.|...:::||
Human     3 LLLTLSFLLASTAAQ------DGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAA 61

  Fly    71 HCLQS------VSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSSLSFS 129
            || ||      :...:|:.|.|...      :...|....|..|.|.:..|||.:|.|......:
Human    62 HC-QSRFMRVRLGEHNLRKRDGPEQ------LRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLN 119

  Fly   130 STIKAIGLASSNPANGAAASVSGWGTES------SGSS----SIPSQLRYVNVNIVSQSRCSSSS 184
            ..::...|.:..|..|.|..|||||..|      :||.    |:|..|...|::|:|.:.|..| 
Human   120 PQVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKS- 183

  Fly   185 YGYGNQIKSSMICAFASGK--DSCQGDSGGPLVSGGVLVGVVSWG-YGCAAANYPGVYADVAALR 246
              |..::.::|:||.|.|:  :||:||||||||.||:|.|:|||| ..|.....||||..|....
Human   184 --YPGRLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCHYL 246

  Fly   247 SWV 249
            .|:
Human   247 EWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 79/237 (33%)
Tryp_SPc 31..252 CDD:238113 80/238 (34%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 79/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5009
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.