DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Prss53

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:321 Identity:78/321 - (24%)
Similarity:128/321 - (39%) Gaps:98/321 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LILLSAV-----------ACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGG 58
            |:::.||           ||...|..|..  || :|..:.|      .:|||.|::|.|.|.|.|
  Rat     9 LLIVGAVIVIEGLQAAQRACGQRGPGPPE--PQ-EGNTLPG------EWPWQASVRRQGVHICSG 64

  Fly    59 SIYSARVIVTAAHCLQSVSASSLQIRAGSSYW------------SSGGVVAKVSSFKNHEGYNAN 111
            |:.:...::|||||.:.::.:.|      |.|            |.|.....|::.:..:.||..
  Rat    65 SLVADTWVLTAAHCFEKMATAEL------SSWSVVLGSLKQEGLSPGAEEVGVAALQLPKAYNHY 123

  Fly   112 TMVNDIAVLHLSSSLSFSSTIKAIGLASSNPAN----GAAASVSGWGTESSGSSSIP------SQ 166
            :..:|:|:|.|:..:..::      |....|.:    ||:...:||...:|.....|      ||
  Rat   124 SQGSDLALLQLTHPIVHTT------LCLPQPTHHFPFGASCWATGWDQNTSDGKYCPRHKSRESQ 182

  Fly   167 ------------------------------LRYVNVNIVSQSRCSSSSYG------YGNQIKSSM 195
                                          ||.:.:.::|:..| :..|.      ..|..:|.|
  Rat   183 TGSVLTVLALCSHCVSELDSTLSPLPVSRTLRNLRLRLISRPTC-NCLYNRLHQRLLANPARSGM 246

  Fly   196 ICAFASG--KDSCQGDSGGPLV-----SGGVLVGVVSWGYGCAAANYPGVYADVAALRSWV 249
            :|..|..  :..||||||||::     ...|.||::|:...||..:.|.:..|:||..||:
  Rat   247 LCGGAQPGVQGPCQGDSGGPVMCREPDGHWVQVGIISFTSNCAQEDTPVLLTDMAAHSSWL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 67/283 (24%)
Tryp_SPc 31..252 CDD:238113 68/284 (24%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 68/282 (24%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343318
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.