DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and CG34130

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:241 Identity:54/241 - (22%)
Similarity:111/241 - (46%) Gaps:44/241 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTAAHCLQS----VSASSLQIRAGSSYW 90
            |..||.|.     ||.:.:....:..||.|..||...:|:|:|:.|    :.:.|:::.:..|  
  Fly    48 RTSGGHAV-----PWLLRIVDGPTFVCGASYLSALYALTSANCMHSHRSQMESLSVELVSSDS-- 105

  Fly    91 SSGGVVAKVSSFKNHEGYNA---NTMVN----------DIAVLHLSSSLSFSSTIKAIGLASSNP 142
                  .:.:...:|:..||   |.:|:          |:||:.|::.|. .:....:.|.::..
  Fly   106 ------RQDNQLDSHDPPNALIRNIIVSKDWHWPGTFMDVAVIELTNRLR-GNRNNYVTLCTNPL 163

  Fly   143 ANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGN-QIKSSMICA--FASGKD 204
            ::..:.||..:|...:      ..:|...:.::::..|.|:   ||| .::.::.||  |....|
  Fly   164 SSYKSLSVVSYGAGPA------ENVRTEEIEVLNRMICDSA---YGNFLLRETVACAKEFKRSAD 219

  Fly   205 SCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVYADVAALRSWVI 250
             |...:|.|:.:|..|.|:|:|...|..:|.||::.|:..::.:::
  Fly   220 -CMFSAGCPVTAGDQLCGIVAWSPACKRSNLPGIFTDIHQVKRFIL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 54/238 (23%)
Tryp_SPc 31..252 CDD:238113 53/240 (22%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 51/233 (22%)
Tryp_SPc 53..256 CDD:304450 50/226 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.