DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Try10

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001034085.1 Gene:Try10 / 436522 MGIID:3687012 Length:246 Species:Mus musculus


Alignment Length:259 Identity:89/259 - (34%)
Similarity:135/259 - (52%) Gaps:33/259 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTA 69
            |:.|:.|..|:...:.:      |.:||||.....:|.|:|:|| .||.|.||||:.:.:.:|:|
Mouse     4 LLFLALVGAAVAFPVDD------DDKIVGGYTCRENSVPYQVSL-NSGYHFCGGSLINDQWVVSA 61

  Fly    70 AHCLQSVSASSLQIRAG----------SSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSS 124
            |||.:    |.:|:|.|          ..:..:..::       .|..:...|:.|||.::.|||
Mouse    62 AHCYK----SRIQVRLGEHNINVLEGNEQFIDAANII-------KHPKFKKKTLDNDIMLIKLSS 115

  Fly   125 SLSFSSTIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGN 189
            .::.::.:..:.|.||..|.|....:||||...|...:.|..|:.::..::.|:.|.:|   |..
Mouse   116 PVTLNARVATVALPSSCAAAGTQCLISGWGNTLSSGVNNPDLLQCLDAPLLPQADCEAS---YPG 177

  Fly   190 QIKSSMICA--FASGKDSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVYADVAALRSWVIN 251
            :|..:|||.  ...||||||||||||:|..|.|.|:||||||||..:.||||..|.....|:.|
Mouse   178 KITKNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKDNPGVYTKVCNYVDWIQN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 82/230 (36%)
Tryp_SPc 31..252 CDD:238113 84/233 (36%)
Try10NP_001034085.1 Tryp_SPc 23..239 CDD:214473 82/230 (36%)
Tryp_SPc 24..242 CDD:238113 84/233 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.