DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and intr

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:258 Identity:62/258 - (24%)
Similarity:103/258 - (39%) Gaps:47/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSAVACALGGTIPEGL--LP-QLDGRIVGGTATT-----ISSFPWQISLQRSGSHSCGGSIYSAR 64
            :||...:.|...|..|  :| :::..:..|.|||     :..|..:|..:  ....|.|::.|.|
  Fly    59 ISARFSSGGNKEPNSLEIIPAEIETLLTDGQATTEAPKAVKHFVMRILYE--NKVICSGALISTR 121

  Fly    65 VIVTAAHC----LQSVSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSS 125
            :::|:|.|    |:.....|.:::|..|         ::.|..|    .....:.|:|:|.|.:.
  Fly   122 LVLTSALCFPRTLRQPPPRSYKLQASRS---------RIYSVAN----LITGAIEDMALLLLHAP 173

  Fly   126 LSFSSTIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQ--LRYVNVNIVSQSRCSSSSYGYG 188
            |. ...:..|.|..| |..           .:...:...||  ||::...::..|.| ..||...
  Fly   174 LE-DPFVHPIDLCES-PLR-----------RNDNVTMYMSQQHLRFLRTKLIPNSNC-KRSYAQD 224

  Fly   189 NQ--IKSSMICAFASGK-DSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPG-VYADVAALRS 247
            ..  |..:|:||..|.: ..||...|..|:....|.||..:|..|:.....| :||||...|:
  Fly   225 ENAFITQTMLCALNSNRLVDCQTAKGDVLLHQDRLCGVDIYGQHCSDGGVNGELYADVFKART 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 56/233 (24%)
Tryp_SPc 31..252 CDD:238113 56/232 (24%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 49/198 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.