DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and CG12951

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:260 Identity:84/260 - (32%)
Similarity:122/260 - (46%) Gaps:22/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQR-SGSHSCGGSIYSARVIVT 68
            ||::.||. .:|...|.      ..|:|.||.:::..:|:.:||:. .|||||||||.|...::|
  Fly    11 LIVILAVT-TVGQAAPS------ISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMT 68

  Fly    69 AAHCLQSVSASSLQIRAGSSYWSS-GGVVAKVSSFKNHEGYNANTM-VNDIAVLHLSSSLSFSST 131
            ||||.....|.:|.|:.|.:..|: |..|..:.....||.::.... .|||::|.:.....|...
  Fly    69 AAHCTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGV 133

  Fly   132 ------IKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQ 190
                  :.|:..|......|....:.|||...: ..|:...|:.|::.|.|...|:|...|..: 
  Fly   134 SVAPVELPALAFAVPQSDAGVEGVLIGWGLNDT-YGSVQDTLQEVSLKIYSDEECTSRHNGQTD- 196

  Fly   191 IKSSMICAFA--SGKDSCQGDSGGPLVSGGVLVGVVSWGY-GCAAANYPGVYADVAALRSWVINN 252
             ....||...  .||..|.|||||||:..|..||:|||.. .|..|.|||||..|:....|:.:|
  Fly   197 -PKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKSN 260

  Fly   253  252
              Fly   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 76/230 (33%)
Tryp_SPc 31..252 CDD:238113 76/232 (33%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 76/230 (33%)
Tryp_SPc 30..260 CDD:238113 76/232 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
33.010

Return to query results.
Submit another query.