DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Tmprss11c

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:238 Identity:89/238 - (37%)
Similarity:125/238 - (52%) Gaps:29/238 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTAAHC-LQSVSASSLQIRAGSSYWSSG 93
            ::.||.......:|||.|||::..|.||.::.|...::||||| ::|.:....::       |.|
  Rat   186 KVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHCFVRSANPKDWKV-------SFG 243

  Fly    94 GVVAK------VSSFKNHEGYNANTMVNDIAVLHLSSSLSFSSTIKAIGLASSN---PANGAAAS 149
            .:::|      |.|...||.|:.....|||||:.|||.:.:.:.|:...|..:.   |.|.... 
  Rat   244 FLLSKPQAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIRRACLPEATQKFPPNSDVV- 307

  Fly   150 VSGWGT-ESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIKSSMICA-FASGK-DSCQGDSG 211
            |:|||| :|.|.|  |:.|:...|.|:....|:|.. .||..|...|:|| |..|: |:||||||
  Rat   308 VTGWGTLKSDGDS--PNILQKGRVKIIDNKTCNSGK-AYGGVITPGMLCAGFLEGRVDACQGDSG 369

  Fly   212 GPLV---SGGV--LVGVVSWGYGCAAANYPGVYADVAALRSWV 249
            ||||   |.|:  |.|:||||..||..|.||||..|...|.|:
  Rat   370 GPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 88/236 (37%)
Tryp_SPc 31..252 CDD:238113 89/237 (38%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 88/236 (37%)
Tryp_SPc 187..415 CDD:238113 89/237 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.